(data stored in ACNUC10821 zone)

EMBL: AE017262.PE93

AE017262.PE93        Location/Qualifiers
FT   CDS             91939..92895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0095"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02883"
FT                   /protein_id="AAT02883.1"
FT                   /translation="MTASVFVAGKLLPETMEALSKWDVKAFSGEENITEAELIKNVTEV
FT                   DAIICPLSSPISAKVLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATA
FT                   ELTLGLILDVARRISEGDRLCRETPEQFKGWAPTFFLGTELSGKTLGIIGLGRIGQAVA
FT                   KRAAAFGMKIIYSGHHPKEAAKEWNAEFVSQEELLKRSDVVTIHAAYSPSLKYLLNETT
FT                   LKTMKSSAFLINAARGPVVEEAALIKALETGVIAGAALDVFEFEPKIGEDLAKLDNVVL
FT                   TPHIGNATVETRTAMGKIAIANVEAVLAGKAPLHSVY"
     MTASVFVAGK LLPETMEALS KWDVKAFSGE ENITEAELIK NVTEVDAIIC PLSSPISAKV        60
     LESAKNLKIV ANIGAGFDNI DVKKAQELGI AVTNTPDVST EATAELTLGL ILDVARRISE       120
     GDRLCRETPE QFKGWAPTFF LGTELSGKTL GIIGLGRIGQ AVAKRAAAFG MKIIYSGHHP       180
     KEAAKEWNAE FVSQEELLKR SDVVTIHAAY SPSLKYLLNE TTLKTMKSSA FLINAARGPV       240
     VEEAALIKAL ETGVIAGAAL DVFEFEPKIG EDLAKLDNVV LTPHIGNATV ETRTAMGKIA       300
     IANVEAVLAG KAPLHSVY                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page