(data stored in ACNUC10821 zone)

EMBL: AE017262.PE94

AE017262.PE94        Location/Qualifiers
FT   CDS             93236..94759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0096"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:16412606; match to
FT                   protein family HMM PF06860"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02884"
FT                   /protein_id="AAT02884.1"
FT                   /translation="MSRIDIGEIQAFLYQLRAANEPGRKTIQSIKAAVTKYVGDNSLKG
FT                   KAVDASKNYYQMTYFPLCDAIIEAMDESEERLGQYIQDFHAEVDSSPDAKIDADGLYEL
FT                   GKMIDRIESKKEALAQRMNSGTEGQMQNYRSQLAIAYKQENILEKYLSFEQSHASFFDH
FT                   LIDLVQAVQQTIRELQSNIQFNSQTGTYDLSKLNHATVSHMQQALNKARGIKEDIIKEL
FT                   QDYTVLAVVYLDSNGKEQVMWLLERDGLGVENAELKAYLEKNGKYLNPEDYSIITNEDL
FT                   NKKINKAWRDGVYYLNGNKYDGLTGGILSTSAYVEAGKGFIDKSGLADVVLGLGLSTAA
FT                   IRGSVTFGKKNKLKGYDYLDDLLGDLNNKVKIKKYDSAESVNKYWHQQNYDQPPYTPKT
FT                   PVQDLELLVETKFVRVYDGGSSKLHGGWLMKAEDIKGLTPTQIKDKFALPNIPKFVGEV
FT                   TLPKGSNIRMGEVNPLFENKGGGIQFDLKGQFIGEFKELGKISEWGGLK"
     MSRIDIGEIQ AFLYQLRAAN EPGRKTIQSI KAAVTKYVGD NSLKGKAVDA SKNYYQMTYF        60
     PLCDAIIEAM DESEERLGQY IQDFHAEVDS SPDAKIDADG LYELGKMIDR IESKKEALAQ       120
     RMNSGTEGQM QNYRSQLAIA YKQENILEKY LSFEQSHASF FDHLIDLVQA VQQTIRELQS       180
     NIQFNSQTGT YDLSKLNHAT VSHMQQALNK ARGIKEDIIK ELQDYTVLAV VYLDSNGKEQ       240
     VMWLLERDGL GVENAELKAY LEKNGKYLNP EDYSIITNED LNKKINKAWR DGVYYLNGNK       300
     YDGLTGGILS TSAYVEAGKG FIDKSGLADV VLGLGLSTAA IRGSVTFGKK NKLKGYDYLD       360
     DLLGDLNNKV KIKKYDSAES VNKYWHQQNY DQPPYTPKTP VQDLELLVET KFVRVYDGGS       420
     SKLHGGWLMK AEDIKGLTPT QIKDKFALPN IPKFVGEVTL PKGSNIRMGE VNPLFENKGG       480
     GIQFDLKGQF IGEFKELGKI SEWGGLK                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page