(data stored in ACNUC10821 zone)

EMBL: AE017262.PE95

AE017262.PE95        Location/Qualifiers
FT   CDS             94741..95118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0097"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02885"
FT                   /protein_id="AAT02885.1"
FT                   /translation="MGRIKVTINAEYIDNKLTAFGKSIEFKNKIVELKENDNCLFVRLL
FT                   VVPGQELNENTLSNVYAINKLGEIQWQIKNVAPKGNNVYICAPLVGMDIEENDLFVTDF
FT                   MGRRFEVNQENGELNQVRIVK"
     MGRIKVTINA EYIDNKLTAF GKSIEFKNKI VELKENDNCL FVRLLVVPGQ ELNENTLSNV        60
     YAINKLGEIQ WQIKNVAPKG NNVYICAPLV GMDIEENDLF VTDFMGRRFE VNQENGELNQ       120
     VRIVK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page