(data stored in ACNUC10821 zone)

EMBL: AE017262.PE96

AE017262.PE96        Location/Qualifiers
FT   CDS             95591..95935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0098"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02886"
FT                   /protein_id="AAT02886.1"
FT                   /translation="MTKITHMNNKLIFENQEYTFEYPIQTLREDKNHVYVLLDIPANQE
FT                   YTFDDFHNIYAFSYTGERKWQIGERPVGDNDVYTLINVKEGILYATDFSGRKYKVCEKN
FT                   GIPEKMEIVK"
     MTKITHMNNK LIFENQEYTF EYPIQTLRED KNHVYVLLDI PANQEYTFDD FHNIYAFSYT        60
     GERKWQIGER PVGDNDVYTL INVKEGILYA TDFSGRKYKV CEKNGIPEKM EIVK             114
//

If you have problems or comments...

PBIL Back to PBIL home page