(data stored in ACNUC10821 zone)

EMBL: AE017262.PE97

AE017262.PE97        Location/Qualifiers
FT   CDS             96061..96402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02887"
FT                   /protein_id="AAT02887.1"
FT                   /translation="MKKLQWLTNRLFATSILLITTLFIIPPTFAIADGSKVSFYEYIYG
FT                   APFRWLTVISTTDKKGAFTEMFFSGNEGITIQWPNLMINFLLIFLAITIIFSLAKKLYD
FT                   KKNVKKDNP"
     MKKLQWLTNR LFATSILLIT TLFIIPPTFA IADGSKVSFY EYIYGAPFRW LTVISTTDKK        60
     GAFTEMFFSG NEGITIQWPN LMINFLLIFL AITIIFSLAK KLYDKKNVKK DNP              113
//

If you have problems or comments...

PBIL Back to PBIL home page