(data stored in ACNUC10821 zone)

EMBL: AE017262.PE98

AE017262.PE98        Location/Qualifiers
FT   CDS             complement(96469..96837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0100"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02888"
FT                   /protein_id="AAT02888.1"
FT                   /translation="MAFSIGEFSELVGIPSSTLRFYEKEGLITPDRDKNNLRIYSEEDA
FT                   NWLKFLLHLKGAGLSVEELKQYTIWRAAGDSTISERLNMLKKKKVILEQEIEDLQKNLD
FT                   TVVRKIGIYEEKVKTRRV"
     MAFSIGEFSE LVGIPSSTLR FYEKEGLITP DRDKNNLRIY SEEDANWLKF LLHLKGAGLS        60
     VEELKQYTIW RAAGDSTISE RLNMLKKKKV ILEQEIEDLQ KNLDTVVRKI GIYEEKVKTR       120
     RV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page