(data stored in ACNUC10821 zone)

EMBL: AE017262.PHNA

AE017262.PHNA        Location/Qualifiers
FT   CDS             409087..409422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="LMOf2365_0386"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="identified by match to protein family HMM PF03831;
FT                   match to protein family HMM TIGR00686"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03171"
FT                   /protein_id="AAT03171.1"
FT                   /translation="MPKLPNCPECNSEYAYEDRGLLICPECGHEWSAVAEEATEEKVFK
FT                   DANGNVLTDGDSVTVIKDLKVKGASNPIKMGTKVKNIRLVDGDHDIDCKIDGFGPMKLK
FT                   SEFVKKI"
     MPKLPNCPEC NSEYAYEDRG LLICPECGHE WSAVAEEATE EKVFKDANGN VLTDGDSVTV        60
     IKDLKVKGAS NPIKMGTKVK NIRLVDGDHD IDCKIDGFGP MKLKSEFVKK I                111
//

If you have problems or comments...

PBIL Back to PBIL home page