(data stored in ACNUC10821 zone)

EMBL: AE017262.PHRB

AE017262.PHRB        Location/Qualifiers
FT   CDS             635685..637088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="LMOf2365_0617"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="identified by similarity to SP:P25078; match to
FT                   protein family HMM PF00875; match to protein family HMM
FT                   PF03441"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03399"
FT                   /protein_id="AAT03399.1"
FT                   /translation="MTSVMWFRRDLRVNDNKALYHACKENDLLLLFQVNPAQFITGSPS
FT                   HQAFFASVAHFKQEIDKTAHLQIMFGEPIECFQQLKDSLPSWDKVYFNRDETGYGAKRD
FT                   EAAQAFFDEQKIEVQAFHDSYLHSAEEVKKSPTEYYKIFTPYYKKWREEIKETPFKVTL
FT                   KHENIRKESLFLKYEEQFAEMTSDLPILDIGERAANTRLANFIKHDVADYDKARDFPEL
FT                   DKTSHLSRYLRTGEISIRTIWQSLQETEATEGRATFEKELCWRDFYNMIYVSFPNQKNE
FT                   PIQENYRFIEWENNREYFKAWQEGKTGFPLVDAAMRQLKETGWMHNRLRMITASFLTKD
FT                   LLIDWRFGEKYFQQMLIDYDPASNIGGWQWAASTGTDAVPYFRIFNPTTQSQKFDSTGK
FT                   FIRKYVKELANLPDKYIHQPEKMSETEQKEHGLLLGKDYPFPIVDHKERRKLAIARYEF
FT                   SKEHSRGNI"
     MTSVMWFRRD LRVNDNKALY HACKENDLLL LFQVNPAQFI TGSPSHQAFF ASVAHFKQEI        60
     DKTAHLQIMF GEPIECFQQL KDSLPSWDKV YFNRDETGYG AKRDEAAQAF FDEQKIEVQA       120
     FHDSYLHSAE EVKKSPTEYY KIFTPYYKKW REEIKETPFK VTLKHENIRK ESLFLKYEEQ       180
     FAEMTSDLPI LDIGERAANT RLANFIKHDV ADYDKARDFP ELDKTSHLSR YLRTGEISIR       240
     TIWQSLQETE ATEGRATFEK ELCWRDFYNM IYVSFPNQKN EPIQENYRFI EWENNREYFK       300
     AWQEGKTGFP LVDAAMRQLK ETGWMHNRLR MITASFLTKD LLIDWRFGEK YFQQMLIDYD       360
     PASNIGGWQW AASTGTDAVP YFRIFNPTTQ SQKFDSTGKF IRKYVKELAN LPDKYIHQPE       420
     KMSETEQKEH GLLLGKDYPF PIVDHKERRK LAIARYEFSK EHSRGNI                     467
//

If you have problems or comments...

PBIL Back to PBIL home page