(data stored in ACNUC10821 zone)

EMBL: AE017262.PLCA

AE017262.PLCA        Location/Qualifiers
FT   CDS             complement(209983..210936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcA"
FT                   /locus_tag="LMOf2365_0212"
FT                   /product="1-phosphatidylinositol phosphodiesterase"
FT                   /note="identified by similarity to GP:887021; similarity to
FT                   SP:P34024; match to protein family HMM PF00388"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02999"
FT                   /protein_id="AAT02999.1"
FT                   /translation="MYKNYLQRTLVLVLCFILCFFTFPLGGKAYSLNNWNKPIKNSVTT
FT                   KQWMSALPDTTSLAALSIPGTHDTMSYNGDMTWTLTKPLAQTQTMSLYQQLEAGIRYID
FT                   IRAKDNLKIYHGPIFLNASLSGVLETITQFLKKNPKETIIMRLKDEQNSNDSFDYRIQP
FT                   LINIYKDYFYTTPRTDTSNKIPTLKDVRGKILLLSENHTKKPLVINSHKFGMQFGASNQ
FT                   VIQDDYNGPSVKTKFKEIVQTAYQASKADNKLFLNHISATSLTFTPRQYAAALNNKVEQ
FT                   FVLNLTSEKVRGLGILIMDFPEKQTIKNIIKNNKFN"
     MYKNYLQRTL VLVLCFILCF FTFPLGGKAY SLNNWNKPIK NSVTTKQWMS ALPDTTSLAA        60
     LSIPGTHDTM SYNGDMTWTL TKPLAQTQTM SLYQQLEAGI RYIDIRAKDN LKIYHGPIFL       120
     NASLSGVLET ITQFLKKNPK ETIIMRLKDE QNSNDSFDYR IQPLINIYKD YFYTTPRTDT       180
     SNKIPTLKDV RGKILLLSEN HTKKPLVINS HKFGMQFGAS NQVIQDDYNG PSVKTKFKEI       240
     VQTAYQASKA DNKLFLNHIS ATSLTFTPRQ YAAALNNKVE QFVLNLTSEK VRGLGILIMD       300
     FPEKQTIKNI IKNNKFN                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page