(data stored in ACNUC10821 zone)

EMBL: AE017262.PROC

AE017262.PROC        Location/Qualifiers
FT   CDS             complement(427515..428315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="LMOf2365_0408"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by similarity to SP:P00373; match to
FT                   protein family HMM PF01089; match to protein family HMM
FT                   TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03193"
FT                   /protein_id="AAT03193.1"
FT                   /translation="MKKIGFIGAGNMGTAMIRGLAQANLDNSEAIIVGGRNLEKLKPLE
FT                   AAFTGLQITTDTEKLVEQADIIILAVKPYTIPEILTSVKEQLTPDKIIISVAAGVTIQD
FT                   LEELTSAKTKIVRVMPNTPALVGEAMSSISPNINVSSEEINEVTAIFTSFGEAEVVSEN
FT                   LMDAVIGVSGSSPAYVYMFIEALADGAVLSGMPRDKAYKFAAQAVLGAAKTVLETGEHP
FT                   GKLKDMVTSPGGTTIEAVKSLENDGFRSAVINAVQAAANKNSSM"
     MKKIGFIGAG NMGTAMIRGL AQANLDNSEA IIVGGRNLEK LKPLEAAFTG LQITTDTEKL        60
     VEQADIIILA VKPYTIPEIL TSVKEQLTPD KIIISVAAGV TIQDLEELTS AKTKIVRVMP       120
     NTPALVGEAM SSISPNINVS SEEINEVTAI FTSFGEAEVV SENLMDAVIG VSGSSPAYVY       180
     MFIEALADGA VLSGMPRDKA YKFAAQAVLG AAKTVLETGE HPGKLKDMVT SPGGTTIEAV       240
     KSLENDGFRS AVINAVQAAA NKNSSM                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page