(data stored in ACNUC10821 zone)

EMBL: AE017262.PURA

AE017262.PURA        Location/Qualifiers
FT   CDS             65079..66371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="LMOf2365_0065"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02853"
FT                   /db_xref="GOA:Q725A8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725A8"
FT                   /protein_id="AAT02853.1"
FT                   /translation="MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKF
FT                   DGVTYKLHLIPSGIFYKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHI
FT                   ILPYHIRIDEADEERKGANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLEHN
FT                   LGEKNRLLERFYELEGFKLEDILEEYYDYGQQFKEYVCDTSVVLNDALDDGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTEL
FT                   FDTIGDTIREVGHEYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETL
FT                   KICVAYKLDGKTITEFPASLKDLARCEPVYEELPGWTEDITGVTSLDDLPVNCRHYMER
FT                   IAQLTGVQVSMFSVGPDRAQTHVIKSVWRLA"
     MSSVVVVGTQ WGDEGKGKIT DFLSENAEAI ARYQGGNNAG HTIKFDGVTY KLHLIPSGIF        60
     YKEKISVIGN GMVVDPKALV EELKYLHDKG VDTSNLRISN RAHIILPYHI RIDEADEERK       120
     GANKIGTTKK GIGPAYMDKA ARVGIRIIDL LDKETFKEKL EHNLGEKNRL LERFYELEGF       180
     KLEDILEEYY DYGQQFKEYV CDTSVVLNDA LDDGKRVLFE GAQGVMLDID QGTYPFVTSS       240
     NPIAGGVTIG SGVGPSKINH VVGVAKAYTT RVGDGPFPTE LFDTIGDTIR EVGHEYGTTT       300
     GRPRRVGWFD SVVVRHARRV SGLTDLSLTL LDVLTGIETL KICVAYKLDG KTITEFPASL       360
     KDLARCEPVY EELPGWTEDI TGVTSLDDLP VNCRHYMERI AQLTGVQVSM FSVGPDRAQT       420
     HVIKSVWRLA                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page