(data stored in ACNUC10821 zone)

EMBL: AE017262.PURR

AE017262.PURR        Location/Qualifiers
FT   CDS             201150..201968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="LMOf2365_0203"
FT                   /product="Pur operon transcriptional repressor"
FT                   /note="identified by similarity to SP:P37551; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01743"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02990"
FT                   /protein_id="AAT02990.1"
FT                   /translation="MKIRRSERLIDMTQFLLSHPRKLVPLTMFAERYGSAKSSISEDLV
FT                   IIKKTFEDRGIGTLETVPGAAGGVQYISIAGNDDVLDFVHTLCNRIAEPNRLLPGGYLY
FT                   LSDLLGEPVTLKAIGKILATKFNNQKIDAIMTVATKGIPIAQAVAEHLSVPFVIVRRDS
FT                   KVTEGSTVSINYVSGSSKRIEKMELSKRSLAEGSNVVIVDDFMKAGGTINGMKNLLEEF
FT                   NAHLVGIGVLVESEYAEERLVDDYVSLVKIKNVNMKEKQIEVVDGNYFNS"
     MKIRRSERLI DMTQFLLSHP RKLVPLTMFA ERYGSAKSSI SEDLVIIKKT FEDRGIGTLE        60
     TVPGAAGGVQ YISIAGNDDV LDFVHTLCNR IAEPNRLLPG GYLYLSDLLG EPVTLKAIGK       120
     ILATKFNNQK IDAIMTVATK GIPIAQAVAE HLSVPFVIVR RDSKVTEGST VSINYVSGSS       180
     KRIEKMELSK RSLAEGSNVV IVDDFMKAGG TINGMKNLLE EFNAHLVGIG VLVESEYAEE       240
     RLVDDYVSLV KIKNVNMKEK QIEVVDGNYF NS                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page