(data stored in ACNUC10821 zone)

EMBL: AE017262.RADA

AE017262.RADA        Location/Qualifiers
FT   CDS             258462..259835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="LMOf2365_0245"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by similarity to SP:P37572; match to
FT                   protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03032"
FT                   /protein_id="AAT03032.1"
FT                   /translation="MAKAKRTTKFVCQACGYESAKWMGKCPNCNEWNQMVEALEPSKKS
FT                   RSAFNHTGEPSKATPITQIASETEKRVETNMPELNRVLGGGVVPGSMVLVGGDPGIGKS
FT                   TLLLQVSAQLTLTNKKVLYISGEESIKQTKLRAERLQVSGDNLYVYAETNLEAVQETID
FT                   FVKPDFVVIDSIQTVYHPDVTSAAGSVSQVRECTATLMRIAKMQNIAIFIVGHVTKEGA
FT                   IAGPRLLEHMVDTVLYFEGERHHAYRILRAVKNRFGSTNEMGIFEMRDVGLVEVANPSE
FT                   VFLEERLEGASGSTVVASMEGTRPVLVEIQALVSPTMFGNAKRMATGIDYNKVSLIMAV
FT                   LEKRVGLMLQNQDAYLKAAGGVKLDEPAVDLAVAVSVASSYRDKPTRSTDCFIGELGLT
FT                   GEIRRVARIEQRVQEAAKLGFKRIFIPKNNEGNWKIPKDVQVVGVETIGEALKKALPD"
     MAKAKRTTKF VCQACGYESA KWMGKCPNCN EWNQMVEALE PSKKSRSAFN HTGEPSKATP        60
     ITQIASETEK RVETNMPELN RVLGGGVVPG SMVLVGGDPG IGKSTLLLQV SAQLTLTNKK       120
     VLYISGEESI KQTKLRAERL QVSGDNLYVY AETNLEAVQE TIDFVKPDFV VIDSIQTVYH       180
     PDVTSAAGSV SQVRECTATL MRIAKMQNIA IFIVGHVTKE GAIAGPRLLE HMVDTVLYFE       240
     GERHHAYRIL RAVKNRFGST NEMGIFEMRD VGLVEVANPS EVFLEERLEG ASGSTVVASM       300
     EGTRPVLVEI QALVSPTMFG NAKRMATGID YNKVSLIMAV LEKRVGLMLQ NQDAYLKAAG       360
     GVKLDEPAVD LAVAVSVASS YRDKPTRSTD CFIGELGLTG EIRRVARIEQ RVQEAAKLGF       420
     KRIFIPKNNE GNWKIPKDVQ VVGVETIGEA LKKALPD                                457
//

If you have problems or comments...

PBIL Back to PBIL home page