(data stored in ACNUC10821 zone)

EMBL: AE017262.RECF

AE017262.RECF        Location/Qualifiers
FT   CDS             4869..5981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LMOf2365_0005"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P05651; match to
FT                   protein family HMM PF02463; match to protein family HMM
FT                   TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02795"
FT                   /db_xref="GOA:Q725G6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725G6"
FT                   /protein_id="AAT02795.1"
FT                   /translation="MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLM
FT                   LALAKSHRTTNDKDFIMWEKEEAKMEGRIAKHGQSVPLELAITQKGKRAKVNHLEQKKL
FT                   SQYVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQMQPIYLHNLSEYQRILQQRNQY
FT                   LKMLQMKRKVDPILLDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQISRGLETLK
FT                   IEYKASITLNGDDPEVWKADLLQKMESIKQREIDRGVTLIGPHRDDSLFYINGQNVQDF
FT                   GSQGQQRTTALSIKLAEIDLIHEETGEYPVLLLDDVLSELDDYRQSHLLGAIEGKVQTF
FT                   VTTTSTSGIDHETLKQATTFYVEKGTVKKS"
     MHLESIVLRN FRNYENLELE FSPSVNVFLG ENAQGKTNLL EAVLMLALAK SHRTTNDKDF        60
     IMWEKEEAKM EGRIAKHGQS VPLELAITQK GKRAKVNHLE QKKLSQYVGN LNVVIFAPED       120
     LSLVKGAPGI RRRFLNMEIG QMQPIYLHNL SEYQRILQQR NQYLKMLQMK RKVDPILLDI       180
     LTEQFADVAI NLTKRRADFI QKLEAYAAPI HHQISRGLET LKIEYKASIT LNGDDPEVWK       240
     ADLLQKMESI KQREIDRGVT LIGPHRDDSL FYINGQNVQD FGSQGQQRTT ALSIKLAEID       300
     LIHEETGEYP VLLLDDVLSE LDDYRQSHLL GAIEGKVQTF VTTTSTSGID HETLKQATTF       360
     YVEKGTVKKS                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page