(data stored in ACNUC10821 zone)

EMBL: AE017262.RPE-1

AE017262.RPE-1       Location/Qualifiers
FT   CDS             548004..548654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe-1"
FT                   /locus_tag="LMOf2365_0534"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="identified by match to protein family HMM PF00834;
FT                   match to protein family HMM PF01816; match to protein
FT                   family HMM TIGR01163"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03316"
FT                   /protein_id="AAT03316.1"
FT                   /translation="MAKIVPSVFGADIGRINEQLEVLEKNGIDLLHVDMMDGSFVPNIA
FT                   FGPDQIKMMKKGTKLQFDVHMMVYEPDRYIPRLVEAGAHMITVHQEATTHLHRTIQLIK
FT                   SYGVRAGVVLNPGTPPSTLEYVLDDIDCILLMTVNPGLGGQKFFQSSLEKIRKTKAYIG
FT                   NRPIQIEVDGGVNAELAKECTLAGADLIVVGSYLFEGDIEANLEKLSKGVLTE"
     MAKIVPSVFG ADIGRINEQL EVLEKNGIDL LHVDMMDGSF VPNIAFGPDQ IKMMKKGTKL        60
     QFDVHMMVYE PDRYIPRLVE AGAHMITVHQ EATTHLHRTI QLIKSYGVRA GVVLNPGTPP       120
     STLEYVLDDI DCILLMTVNP GLGGQKFFQS SLEKIRKTKA YIGNRPIQIE VDGGVNAELA       180
     KECTLAGADL IVVGSYLFEG DIEANLEKLS KGVLTE                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page