(data stored in ACNUC10821 zone)

EMBL: AE017262.RPIB-1

AE017262.RPIB-1      Location/Qualifiers
FT   CDS             complement(389968..390414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB-1"
FT                   /locus_tag="LMOf2365_0365"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by similarity to SP:P37351; match to
FT                   protein family HMM PF02502; match to protein family HMM
FT                   TIGR00689; match to protein family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03151"
FT                   /protein_id="AAT03151.1"
FT                   /translation="MKIAIGCDEMGYELKQTLITRLKEKNIEFTDFGSFENEKVLYPSI
FT                   AEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIM
FT                   TMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQKNR"
     MKIAIGCDEM GYELKQTLIT RLKEKNIEFT DFGSFENEKV LYPSIAEKVA LEVKNNDYDR        60
     GILICGTGIG MAITANKIHG IRAAQIHDSY SAERARKSND AHIMTMGALV IGPSLAVSLL       120
     DTWLDSDFSG GRSQAKVDLM EEIDQKNR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page