(data stored in ACNUC10821 zone)

EMBL: AE017262.RPIB-2

AE017262.RPIB-2      Location/Qualifiers
FT   CDS             542537..542986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB-2"
FT                   /locus_tag="LMOf2365_0527"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by similarity to SP:P37351; match to
FT                   protein family HMM PF02502; match to protein family HMM
FT                   TIGR00689; match to protein family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03309"
FT                   /protein_id="AAT03309.1"
FT                   /translation="MEIAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVDFPEY
FT                   AAKVGHFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLC
FT                   LGERVLGDSLALLLLDTWLAAEFEGGRHNTRLAKLAELEEPEEDK"
     MEIAIAADHG GFQLKEKIRA HLIESGYTVK DFGCYSLESV DFPEYAAKVG HFVATENSLG        60
     VLCCGTGIGM SMAANKIKGV RAAVVSDAFS AMMTRRHNNS NVLCLGERVL GDSLALLLLD       120
     TWLAAEFEGG RHNTRLAKLA ELEEPEEDK                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page