(data stored in ACNUC10821 zone)

EMBL: AE017262.RPLI

AE017262.RPLI        Location/Qualifiers
FT   CDS             62997..63443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="LMOf2365_0062"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02850"
FT                   /db_xref="GOA:Q725B1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725B1"
FT                   /protein_id="AAT02850.1"
FT                   /translation="MKVIFLKDVKGKGKKGETKNVADGYANNFLIKNGYAVEANNAALS
FT                   TLSAQKKKEDKLAAEELAEAKALKEKMENLTVELKAKSGEGGRLFGSITSKQIAQTLEK
FT                   THGIKIDKRKMDLPEAIRALGHTKVPVKLHHEVTATLDVHVSEE"
     MKVIFLKDVK GKGKKGETKN VADGYANNFL IKNGYAVEAN NAALSTLSAQ KKKEDKLAAE        60
     ELAEAKALKE KMENLTVELK AKSGEGGRLF GSITSKQIAQ TLEKTHGIKI DKRKMDLPEA       120
     IRALGHTKVP VKLHHEVTAT LDVHVSEE                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page