(data stored in ACNUC10821 zone)

EMBL: AE017262.RPLK

AE017262.RPLK        Location/Qualifiers
FT   CDS             270290..270715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="LMOf2365_0260"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03047"
FT                   /db_xref="GOA:Q724G4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G4"
FT                   /protein_id="AAT03047.1"
FT                   /translation="MAKKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAKVEKGSGEPNKTKVASVTRAQ
FT                   VQEIAETKMPDLNAANVESAMLMVEGTARSMGITIQD"
     MAKKVIKEVK LQIPAGKANP APPVGPALGQ AGVNIMGFCK EFNARTADQA GLIIPVVITV        60
     FEDRSFTFIT KTPPAAVLLK KAAKVEKGSG EPNKTKVASV TRAQVQEIAE TKMPDLNAAN       120
     VESAMLMVEG TARSMGITIQ D                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page