(data stored in ACNUC10821 zone)

EMBL: AE017262.RPLL

AE017262.RPLL        Location/Qualifiers
FT   CDS             272271..272633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="LMOf2365_0263"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03050"
FT                   /db_xref="GOA:Q724G1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G1"
FT                   /protein_id="AAT03050.1"
FT                   /translation="MALNIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVAVAAAG
FT                   GAAAEQTEFTVELASAGDSKIKVIKVVREITGLGLKEAKELVDNAPKALKEGVAKEEAE
FT                   EIKAKLEEVGANVEVK"
     MALNIEEIIA SVKEASVLEL NDLVKAIEEE FGVTAAAPVA VAAAGGAAAE QTEFTVELAS        60
     AGDSKIKVIK VVREITGLGL KEAKELVDNA PKALKEGVAK EEAEEIKAKL EEVGANVEVK       120
//

If you have problems or comments...

PBIL Back to PBIL home page