(data stored in ACNUC10821 zone)

EMBL: AE017262.RPOB

AE017262.RPOB        Location/Qualifiers
FT   CDS             283309..286863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LMOf2365_0274"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P37870; match to
FT                   protein family HMM PF00562; match to protein family HMM
FT                   PF04560; match to protein family HMM PF04561; match to
FT                   protein family HMM PF04563; match to protein family HMM
FT                   PF04565; match to protein family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03061"
FT                   /db_xref="GOA:Q724F0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724F0"
FT                   /protein_id="AAT03061.1"
FT                   /translation="MSGHSGHDVKYGRHRTRRSFARISEVLELPNLIEIQTASYQWFLD
FT                   EGLREMFRDISPIEDFAGNLSLEFIDYDLGEPKYSVEESKNRDANYAAPLRVKLRLINK
FT                   ETGEVKDQEVFMGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFNGKLDKNGKKGFGS
FT                   TVIPNRGAWLEYETDAKDVVHVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNDYLRN
FT                   TLEKDNTDNAEKALLEIYERLRPGEPPTVDNARSLLVSRFFDPKRYDLASVGRYKINKK
FT                   LHLKNRLFNQTLAETLVDPETGEIIASKGDILDRRNLDQIIPNLENGVGFRTLRPTDGV
FT                   MEDSVLVQSIKIYAPNDEEKEINIIGNAYIEENVKHITPSDIISSISYFFNLLHGVGDT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDMTTITPQQLINIRPVVAS
FT                   IKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRERAGYEVRDVHYSHYGRMCP
FT                   IETPEGPNIGLINSLSSFAKVNKFGFIETPYRRVDPETNRVTDKIDYLTADEEDNYVVA
FT                   QANSKLDEQGTFTEEEVMARFRSENLAVEKERIDYMDVSPKQVVSVATACIPFLENDDS
FT                   NRALMGANMQRQAVPLMHPEAPFVGTGMEHVSAKDSGAAVTAKHDGIVEHVEAREIWVR
FT                   RVSLVDGKEVTGGIDKYTLRKFVRSNQGTCYNQRPNVAEGDRVVKGEILGNGPSMDSGE
FT                   LALGRNVLVAFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEFESEARDTKLGPEEMTR
FT                   DIPNVGEDALRDLDERGIIRVGAEVKDNDLLVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGGGGIVLDVKIFTREAGDELPPGVNQLVRVYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPFMPDGTPVDIMLNPLGVPSRMNIGQVLELHLGMAARALGIHVA
FT                   TPVFDGANEEDVWSTVEEAGMARDAKTILYDGRSGEAFDNRISVGVMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGR
FT                   VKTYEAIVKGESVPEPGVPESFKVLIKELQSLGMDVKMLSADEEEIEMRDMDDDDFTNQ
FT                   NDAFNIVQPENAAAEKTE"
     MSGHSGHDVK YGRHRTRRSF ARISEVLELP NLIEIQTASY QWFLDEGLRE MFRDISPIED        60
     FAGNLSLEFI DYDLGEPKYS VEESKNRDAN YAAPLRVKLR LINKETGEVK DQEVFMGDFP       120
     LMTEMGTFII NGAERVIVSQ LVRSPGVYFN GKLDKNGKKG FGSTVIPNRG AWLEYETDAK       180
     DVVHVRIDRT RKLPVTVLLR ALGFGSDQEI IDLIGDNDYL RNTLEKDNTD NAEKALLEIY       240
     ERLRPGEPPT VDNARSLLVS RFFDPKRYDL ASVGRYKINK KLHLKNRLFN QTLAETLVDP       300
     ETGEIIASKG DILDRRNLDQ IIPNLENGVG FRTLRPTDGV MEDSVLVQSI KIYAPNDEEK       360
     EINIIGNAYI EENVKHITPS DIISSISYFF NLLHGVGDTD DIDHLGNRRL RSVGELLQNQ       420
     FRIGLSRMER VVRERMSIQD MTTITPQQLI NIRPVVASIK EFFGSSQLSQ FMDQTNPLGE       480
     LTHKRRLSAL GPGGLTRERA GYEVRDVHYS HYGRMCPIET PEGPNIGLIN SLSSFAKVNK       540
     FGFIETPYRR VDPETNRVTD KIDYLTADEE DNYVVAQANS KLDEQGTFTE EEVMARFRSE       600
     NLAVEKERID YMDVSPKQVV SVATACIPFL ENDDSNRALM GANMQRQAVP LMHPEAPFVG       660
     TGMEHVSAKD SGAAVTAKHD GIVEHVEARE IWVRRVSLVD GKEVTGGIDK YTLRKFVRSN       720
     QGTCYNQRPN VAEGDRVVKG EILGNGPSMD SGELALGRNV LVAFMTWDGY NYEDAIIMSE       780
     RLVKDDVYTS IHIEEFESEA RDTKLGPEEM TRDIPNVGED ALRDLDERGI IRVGAEVKDN       840
     DLLVGKVTPK GVTELTAEER LLHAIFGEKA REVRDTSLRV PHGGGGIVLD VKIFTREAGD       900
     ELPPGVNQLV RVYIVQKRKI HEGDKMAGRH GNKGVISRIL PEEDMPFMPD GTPVDIMLNP       960
     LGVPSRMNIG QVLELHLGMA ARALGIHVAT PVFDGANEED VWSTVEEAGM ARDAKTILYD      1020
     GRSGEAFDNR ISVGVMYMIK LAHMVDDKLH ARSTGPYSLV TQQPLGGKAQ FGGQRFGEME      1080
     VWALEAYGAA YTLQEILTIK SDDVVGRVKT YEAIVKGESV PEPGVPESFK VLIKELQSLG      1140
     MDVKMLSADE EEIEMRDMDD DDFTNQNDAF NIVQPENAAA EKTE                       1184
//

If you have problems or comments...

PBIL Back to PBIL home page