(data stored in ACNUC10821 zone)

EMBL: AE017262.RPOC

AE017262.RPOC        Location/Qualifiers
FT   CDS             287034..290639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="LMOf2365_0275"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P37871; match to
FT                   protein family HMM PF00623; match to protein family HMM
FT                   PF04983; match to protein family HMM PF04997; match to
FT                   protein family HMM PF04998; match to protein family HMM
FT                   PF05000; match to protein family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03062"
FT                   /db_xref="GOA:Q724E9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724E9"
FT                   /protein_id="AAT03062.1"
FT                   /translation="MLDVNNFEYMKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKKQLLSEREYRVYREKYG
FT                   KGFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQRRTRAIRRLEVMEAFRNSGNN
FT                   PSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRGLAHNIKSAKRKIERMAPEIWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFK
FT                   DINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFP
FT                   YINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKFHITE
FT                   TSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITD
FT                   DERYERVIGVWNAAKDEIQGKLILSLDRLNPIFMMQDSGARGNISNFTQLAGMRGLMAD
FT                   PSGRIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLTIKAIREGTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEA
FT                   IATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAIITEVGGEVVSIEEGRDRQQ
FT                   EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLL
FT                   AEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAI
FT                   LSGSQPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   LGKLVPAGTGIGRYRKLKSEVIKETAEVTDEITNI"
     MLDVNNFEYM KIGLASPDKI RSWSHGEVKK PETINYRTLK PERDGLFCER IFGPMKDWEC        60
     SCGKYKRVRY KGVVCDRCGV EVTKSKVRRE RMGHIELAAP VSHIWYFKGI PSRMGLVMDM       120
     SPRALEEIIY FASYVVTEPG DTPLEKKQLL SEREYRVYRE KYGKGFSAGM GAEAIKKILA       180
     DIDLEKETND LKEELKSAQG QRRTRAIRRL EVMEAFRNSG NNPSWMVLDV LPVIPPEIRP       240
     MVQLEGGRFA TSDLNDLYRR VINRNNRLKR LLDLGAPNII VQNEKRMLQE AVDALIDNGR       300
     RGRPVTGPGN RPLKSLSHML KGKQGRFRQN LLGKRVDYSG RSVIVVGPNL KMYQCGLPKE       360
     MALELFKPFV MKELVGRGLA HNIKSAKRKI ERMAPEIWDV LEEVIREHPV LLNRAPTLHR       420
     LGIQAFEPTL VEGRAIRLHP LVCTAYNADF DGDQMAVHVP LSAEAQAEAR ILMLAAQNIL       480
     NPKDGKPVVT PSQDMVLGNY YLTLERENAV GEGTIFKDIN EAQLAYQNGY VHLHSRIAVF       540
     AGSIPNERFT DEQRNQLLIT TVGKLIFNTI LPKSFPYINE PTKFNLEIET PAKYFVDTTT       600
     DVRAHIAAQE LIDPFKKKIL GNIIAEVFKK FHITETSKML DRMKDLGFKI STKAGMTVGI       660
     ADILTLEEKH EILEKAHDTV EKITKSFRRG LITDDERYER VIGVWNAAKD EIQGKLILSL       720
     DRLNPIFMMQ DSGARGNISN FTQLAGMRGL MADPSGRIVE LPITSNFREG LTVLEYFIST       780
     HGARKGLTDT ALKTADSGYL TRRLVDVAQD VIIREDDCGT DRGLTIKAIR EGTEIIEPLE       840
     ERLEGRYSRK TIRHPETKEV IARENDLITE AIATQIVDAG IEEVTIRSAF TCNTKHGVCK       900
     KCYGKNLATG TEVEVGEAVG IIAAQSIGEP GTQLTMRTFH TGGVAGDDIT QGLPRIQEIF       960
     EARNPKGQAI ITEVGGEVVS IEEGRDRQQE ITIQGTDDRR SYNIPYTARL RVEEGTIVER      1020
     GEALTEGSVD PKALIRVRDV LSVQEYLLAE VQKVYRMQGV EIGDKHVEVM VRQMLRKIRV      1080
     MDTGDTNILP GTLMDIHTFT EANRDAILSG SQPATGRPVL LGITKASLET DSFLSAASFQ      1140
     ETTRVLTDAA IKGKRDELLG LKENVILGKL VPAGTGIGRY RKLKSEVIKE TAEVTDEITN      1200
     I                                                                      1201
//

If you have problems or comments...

PBIL Back to PBIL home page