(data stored in ACNUC10821 zone)

EMBL: AE017262.RPSF

AE017262.RPSF        Location/Qualifiers
FT   CDS             55768..56061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="LMOf2365_0053"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02841"
FT                   /db_xref="GOA:Q725C0"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725C0"
FT                   /protein_id="AAT02841.1"
FT                   /translation="MARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWG
FT                   KRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEEA"
     MARKYEIMYI IRPNIEEDEK KAVVERFDGI LTENGAEIIE SKEWGKRRLA YEINDYRDGF        60
     YHIVKLNADK ADSINEFDRL AKISDDIIRH MVIKEEA                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page