(data stored in ACNUC10821 zone)

EMBL: AE017262.SECE

AE017262.SECE        Location/Qualifiers
FT   CDS             268796..268975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="LMOf2365_0257"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by similarity to SP:Q06799; match to
FT                   protein family HMM PF00584; match to protein family HMM
FT                   TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03044"
FT                   /protein_id="AAT03044.1"
FT                   /translation="MSAIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFM
FT                   LIDFGIEQIIKLIV"
     MSAIARFFRN VSSEMHKVTW PTRKELLTYT VTVVITVVLF ALFFMLIDFG IEQIIKLIV         59
//

If you have problems or comments...

PBIL Back to PBIL home page