(data stored in ACNUC10821 zone)

EMBL: AE017262.SPEG

AE017262.SPEG        Location/Qualifiers
FT   CDS             12257..12775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="LMOf2365_0009"
FT                   /product="spermidine N1-acetyltransferase"
FT                   /EC_number="2.3.1.57"
FT                   /note="identified by similarity to SP:P37354; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02799"
FT                   /protein_id="AAT02799.1"
FT                   /translation="MSGDLKLRPLEREDLKFVHRLNNDAKIMSYWFEEPYEAFVELQEL
FT                   YDKHIHDQSERRFILELDGQMVGLVELMEIDYIHRRAEFQIIIDPKFQGHGYAVSATKL
FT                   AMKYAFHVLNLHKLYLVVDKVNEKAIHVYEKVGFIREGELIDEFFVDGTYHDAIRMCIF
FT                   QHQYQEMDI"
     MSGDLKLRPL EREDLKFVHR LNNDAKIMSY WFEEPYEAFV ELQELYDKHI HDQSERRFIL        60
     ELDGQMVGLV ELMEIDYIHR RAEFQIIIDP KFQGHGYAVS ATKLAMKYAF HVLNLHKLYL       120
     VVDKVNEKAI HVYEKVGFIR EGELIDEFFV DGTYHDAIRM CIFQHQYQEM DI               172
//

If you have problems or comments...

PBIL Back to PBIL home page