(data stored in ACNUC10821 zone)

EMBL: AE017262.SPOVG-2

AE017262.SPOVG-2     Location/Qualifiers
FT   CDS             205878..206186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG-2"
FT                   /locus_tag="LMOf2365_0208"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by similarity to SP:P28015; match to
FT                   protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02995"
FT                   /db_xref="GOA:Q724L6"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L6"
FT                   /protein_id="AAT02995.1"
FT                   /translation="MQVTDVRLRRVETDGRMRAIASITLDEEFVVHDIRVIDGNNGLFV
FT                   AMPSKRGVDGEFRDIAHPINSDTRAKIQEVVLAEYERVGEEEATAVTEEESESVSAE"
     MQVTDVRLRR VETDGRMRAI ASITLDEEFV VHDIRVIDGN NGLFVAMPSK RGVDGEFRDI        60
     AHPINSDTRA KIQEVVLAEY ERVGEEEATA VTEEESESVS AE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page