(data stored in ACNUC10821 zone)

EMBL: AE017262.SRLA

AE017262.SRLA        Location/Qualifiers
FT   CDS             complement(589108..589629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srlA"
FT                   /locus_tag="LMOf2365_0573"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P56579; match to
FT                   protein family HMM PF03608; match to protein family HMM
FT                   TIGR00821"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03355"
FT                   /protein_id="AAT03355.1"
FT                   /translation="MNYIEWFGTNFIGLFEAGGKQFVSFMTGIVPLLIVLLTFTYSIIA
FT                   FIGEERVNRAIQFSAKNMILRYTLMPVLSVLMLTNPMAYTFGRFVKEHQKPAFYDSVVS
FT                   FLHPVTGLFPYANAGELFVYLGIANGVVEAGYSMSSLAVRYFLAGIVVILMRGVITESI
FT                   TKFLMRKEKV"
     MNYIEWFGTN FIGLFEAGGK QFVSFMTGIV PLLIVLLTFT YSIIAFIGEE RVNRAIQFSA        60
     KNMILRYTLM PVLSVLMLTN PMAYTFGRFV KEHQKPAFYD SVVSFLHPVT GLFPYANAGE       120
     LFVYLGIANG VVEAGYSMSS LAVRYFLAGI VVILMRGVIT ESITKFLMRK EKV              173
//

If you have problems or comments...

PBIL Back to PBIL home page