(data stored in ACNUC10821 zone)

EMBL: AE017262.SRLB

AE017262.SRLB        Location/Qualifiers
FT   CDS             complement(587732..588082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srlB"
FT                   /locus_tag="LMOf2365_0571"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by similarity to SP:P05706; match to
FT                   protein family HMM PF03829"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03353"
FT                   /protein_id="AAT03353.1"
FT                   /translation="MTISKIMEIGPLVPAFEEEKIVILFGPTATNELREISVIHEFQDV
FT                   PNNALTKGNTLLIGEQAYTIEEVGSDANKNLEELGHISVYFRSGQNEVLPGAIVVSPEI
FT                   FPTITVGDSIQF"
     MTISKIMEIG PLVPAFEEEK IVILFGPTAT NELREISVIH EFQDVPNNAL TKGNTLLIGE        60
     QAYTIEEVGS DANKNLEELG HISVYFRSGQ NEVLPGAIVV SPEIFPTITV GDSIQF           116
//

If you have problems or comments...

PBIL Back to PBIL home page