(data stored in ACNUC10821 zone)

EMBL: AE017262.THID-1

AE017262.THID-1      Location/Qualifiers
FT   CDS             354747..355550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD-1"
FT                   /locus_tag="LMOf2365_0335"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03121"
FT                   /protein_id="AAT03121.1"
FT                   /translation="MIFKQVLTIAGSDSGGGAGIQADIKTFQERKTFGMSVITAITAQN
FT                   TLGVKAVHKIPVEMIREQCDAIAEDFQVSAVKTGMLADAEIIREVARNIRLHNFPNIVI
FT                   DPVMIAKGGTALLENEATQVLKDELLPLGTIITPNIPEAEEILGEKITTKAEIEQAAKK
FT                   IFDIGVKAVVIKGGHSKMSEAADFYYDGETTKWLTSERFDTPHTHGTGCTFSACIAAEL
FT                   AKGNSLLDSVMVAKEFITSAIKYPLGIGHGHGPTNHFAYRLEDGK"
     MIFKQVLTIA GSDSGGGAGI QADIKTFQER KTFGMSVITA ITAQNTLGVK AVHKIPVEMI        60
     REQCDAIAED FQVSAVKTGM LADAEIIREV ARNIRLHNFP NIVIDPVMIA KGGTALLENE       120
     ATQVLKDELL PLGTIITPNI PEAEEILGEK ITTKAEIEQA AKKIFDIGVK AVVIKGGHSK       180
     MSEAADFYYD GETTKWLTSE RFDTPHTHGT GCTFSACIAA ELAKGNSLLD SVMVAKEFIT       240
     SAIKYPLGIG HGHGPTNHFA YRLEDGK                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page