(data stored in ACNUC10821 zone)

EMBL: AE017262.THIE

AE017262.THIE        Location/Qualifiers
FT   CDS             355547..356191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="LMOf2365_0336"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03122"
FT                   /db_xref="GOA:Q723Y9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723Y9"
FT                   /protein_id="AAT03122.1"
FT                   /translation="MRAELAVYFIAGTQDIVRGTLPGVLEEALKAGITCFQYREKGAGS
FT                   LQTASERKEMALECQQLCTKYQVPFIINDDVALALEIGADGIHVGQNDEEIRQVIASCA
FT                   GKMKIGLSVHSVSEAEEAERLGAVDYIGVGPIFPTISKADAESVSGTAILEEIRRAGIK
FT                   LPIVGIGGINETNSAEVLTAGADGVSVISAITRSDDCYSVIKQLKNPGYPS"
     MRAELAVYFI AGTQDIVRGT LPGVLEEALK AGITCFQYRE KGAGSLQTAS ERKEMALECQ        60
     QLCTKYQVPF IINDDVALAL EIGADGIHVG QNDEEIRQVI ASCAGKMKIG LSVHSVSEAE       120
     EAERLGAVDY IGVGPIFPTI SKADAESVSG TAILEEIRRA GIKLPIVGIG GINETNSAEV       180
     LTAGADGVSV ISAITRSDDC YSVIKQLKNP GYPS                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page