(data stored in ACNUC10821 zone)

EMBL: AE017262.THIM

AE017262.THIM        Location/Qualifiers
FT   CDS             353953..354750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="LMOf2365_0334"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="identified by match to protein family HMM PF02110;
FT                   match to protein family HMM TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03120"
FT                   /db_xref="GOA:Q723Z1"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723Z1"
FT                   /protein_id="AAT03120.1"
FT                   /translation="MTLEKVWEKGPLVHNITNIVVANDSANGLLAIGASPIMGSAKEEM
FT                   DELAKMADVLVINIGTLDGELVTAMKIAGRAANVAGTPVVLDPVGVGATSYRRKVVQEL
FT                   LAEIQFTAIRGNAGELAAIAGEAWEAKGVDAGVGSADVLSIAEKVANEWSTVVIISGEV
FT                   DVISDGTRFAKVANGSALLPRITGSGCLLSAVCGSFMAVQDDAFRASVEACASYAVASE
FT                   YAEIELERKLPGSFRPQFLDALASWSVEKTRAKAKIQESGEHK"
     MTLEKVWEKG PLVHNITNIV VANDSANGLL AIGASPIMGS AKEEMDELAK MADVLVINIG        60
     TLDGELVTAM KIAGRAANVA GTPVVLDPVG VGATSYRRKV VQELLAEIQF TAIRGNAGEL       120
     AAIAGEAWEA KGVDAGVGSA DVLSIAEKVA NEWSTVVIIS GEVDVISDGT RFAKVANGSA       180
     LLPRITGSGC LLSAVCGSFM AVQDDAFRAS VEACASYAVA SEYAEIELER KLPGSFRPQF       240
     LDALASWSVE KTRAKAKIQE SGEHK                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page