(data stored in ACNUC10821 zone)

EMBL: AE017262.TKT-1

AE017262.TKT-1       Location/Qualifiers
FT   CDS             complement(386477..388474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt-1"
FT                   /locus_tag="LMOf2365_0362"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03148"
FT                   /protein_id="AAT03148.1"
FT                   /translation="MSRIDEQMVNSIRVLSMDMIEKANSGHPGLPMGAAPMAFSLWKNH
FT                   LKFNPEHPTWFNRDRFVLSAGHGSAMLYSLLHLFGYDLPMSELKNFRQTGSKTPGHPEF
FT                   GHTVGVDATTGPLGQGFAMGVGMAMAEAHLGAKFNQPEFPVVDHNTYVLCGDGCLMEGI
FT                   SYEAASLAGHLKLGKLVVLYDSNDISLDGDLNESFSEDIELRFRAAGWQTLRVDDGNDL
FT                   DALDAAIHLAKTEKSRPTLIEVKTVIGYGSPGKAGKSAAHGSPLGEKELKLAKEAYDWQ
FT                   MPPFELPKTVENQKEFYHSKGRASESSWLRTFNAYKQKYPALAESLQQLMDDNLDADWD
FT                   AELPVFDENADKAVATREVSGIVLQELEKKLPNLFGGAADLASSNKTHLKASERFAPGN
FT                   YAAKNISFGVREFAMGAAVNGMTLHGGVQAFGATFFVFSDYLRSAIRSAALMGIPSTFI
FT                   MTHDSIAVGEDGPTHEPIEHLASFRAMPGLHVIRPADGNETVEAYRYAFTQKEQPTMLV
FT                   LSRQNLPILPNSAAKAQTGLAKGAYILADSPLDKLDIILLASGSEVHLMTAVRDNLAKK
FT                   GFGARVVSMPSFDLFDKQSPEYKESVLPKAVKNRFAAEMGASYGWHKYLGDTGQILAID
FT                   SFGMSGPGDELARRFGFTVENLTELALKQL"
     MSRIDEQMVN SIRVLSMDMI EKANSGHPGL PMGAAPMAFS LWKNHLKFNP EHPTWFNRDR        60
     FVLSAGHGSA MLYSLLHLFG YDLPMSELKN FRQTGSKTPG HPEFGHTVGV DATTGPLGQG       120
     FAMGVGMAMA EAHLGAKFNQ PEFPVVDHNT YVLCGDGCLM EGISYEAASL AGHLKLGKLV       180
     VLYDSNDISL DGDLNESFSE DIELRFRAAG WQTLRVDDGN DLDALDAAIH LAKTEKSRPT       240
     LIEVKTVIGY GSPGKAGKSA AHGSPLGEKE LKLAKEAYDW QMPPFELPKT VENQKEFYHS       300
     KGRASESSWL RTFNAYKQKY PALAESLQQL MDDNLDADWD AELPVFDENA DKAVATREVS       360
     GIVLQELEKK LPNLFGGAAD LASSNKTHLK ASERFAPGNY AAKNISFGVR EFAMGAAVNG       420
     MTLHGGVQAF GATFFVFSDY LRSAIRSAAL MGIPSTFIMT HDSIAVGEDG PTHEPIEHLA       480
     SFRAMPGLHV IRPADGNETV EAYRYAFTQK EQPTMLVLSR QNLPILPNSA AKAQTGLAKG       540
     AYILADSPLD KLDIILLASG SEVHLMTAVR DNLAKKGFGA RVVSMPSFDL FDKQSPEYKE       600
     SVLPKAVKNR FAAEMGASYG WHKYLGDTGQ ILAIDSFGMS GPGDELARRF GFTVENLTEL       660
     ALKQL                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page