(data stored in ACNUC10821 zone)

EMBL: AE017262.TPIA-1

AE017262.TPIA-1      Location/Qualifiers
FT   CDS             complement(390421..391185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA-1"
FT                   /locus_tag="LMOf2365_0366"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by match to protein family HMM PF00121"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03152"
FT                   /db_xref="GOA:Q723V9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723V9"
FT                   /protein_id="AAT03152.1"
FT                   /translation="MRKPLVGINMKNYINTRAQTSEWLEATIPLLKNFSDVDTFIFPSM
FT                   GTLETTANLLAGTSFGFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFH
FT                   EKTSEIAKKIKLALDEKITPVVCVGEEVRANDTNELKNALKKQIEALFQTINLAQWENV
FT                   VLAYEPEWAIGKASSAETNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIV
FT                   RQKNVDGLFVGRFGHKPQNFADIVSIVSKTKG"
     MRKPLVGINM KNYINTRAQT SEWLEATIPL LKNFSDVDTF IFPSMGTLET TANLLAGTSF        60
     GFGPQNMAPE KSGPLTGEFS VESIIDLNAN YVEIGHAERK NLFHEKTSEI AKKIKLALDE       120
     KITPVVCVGE EVRANDTNEL KNALKKQIEA LFQTINLAQW ENVVLAYEPE WAIGKASSAE       180
     TNYIESAHQA LREIIRELGG DETLVRIIYG GSVSKENAAE IVRQKNVDGL FVGRFGHKPQ       240
     NFADIVSIVS KTKG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page