(data stored in ACNUC30630 zone)

EMBL: AE017283.PE102

AE017283.PE102       Location/Qualifiers
FT   CDS             complement(128687..129955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0107"
FT                   /product="periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81867"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR2"
FT                   /protein_id="AAT81867.1"
FT                   /translation="MSTPRTMPRRISALITLFVAPALALTGCSGSSNRTTSLNTSTATP
FT                   SVGTGANMSGCIKSGEFDKDKDYFGDKATFTGARNVHVSYHKSYKVLTLGEQDRPAQTF
FT                   VLLQCGAPKPALTGDLAKAPIIDVPVKRVVASSTTQIPVFHTLGALDSIVGVNQIEQIY
FT                   RGPARKALEARHIPSYGSSRMQIDTEKIISLKPDAVLAASSEVGEFKQVQSAGIPVLQD
FT                   LDYLESTPLARAEWMKAYGILLNKEGAATKSFDSIAERYAEVAKKAKNAADKPSVLVGQ
FT                   ETKGQWYVPGADSYMIKFMTDAGASDVMAQAVKGNGATPTDAEVVFKYGSKADFWLNGN
FT                   YMSMTTWHGKDDALKQNPRYANLSAFQHGNVWNPSKRTAPDTGNDFWQSGIVQPDVVLA
FT                   DLTYIFHPDLMKGYTPYYYTKLS"
     MSTPRTMPRR ISALITLFVA PALALTGCSG SSNRTTSLNT STATPSVGTG ANMSGCIKSG        60
     EFDKDKDYFG DKATFTGARN VHVSYHKSYK VLTLGEQDRP AQTFVLLQCG APKPALTGDL       120
     AKAPIIDVPV KRVVASSTTQ IPVFHTLGAL DSIVGVNQIE QIYRGPARKA LEARHIPSYG       180
     SSRMQIDTEK IISLKPDAVL AASSEVGEFK QVQSAGIPVL QDLDYLESTP LARAEWMKAY       240
     GILLNKEGAA TKSFDSIAER YAEVAKKAKN AADKPSVLVG QETKGQWYVP GADSYMIKFM       300
     TDAGASDVMA QAVKGNGATP TDAEVVFKYG SKADFWLNGN YMSMTTWHGK DDALKQNPRY       360
     ANLSAFQHGN VWNPSKRTAP DTGNDFWQSG IVQPDVVLAD LTYIFHPDLM KGYTPYYYTK       420
     LS                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page