(data stored in ACNUC30630 zone)

EMBL: AE017283.PE104

AE017283.PE104       Location/Qualifiers
FT   CDS             complement(131052..132836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0109"
FT                   /product="myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81869"
FT                   /db_xref="GOA:Q6ABR0"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR0"
FT                   /protein_id="AAT81869.1"
FT                   /translation="MTNFQDIYQHSYPVSPDGNPFVQNDLGRYTQNHPVPPDDVAERKA
FT                   YLVGSGIASLLAAAYLIRDAQMPGENITILEEMSEPGGAFDGAGDTEKGFIARGGREMG
FT                   QHFECFWDIMKDIPALEMPEPYSVLDEFRIVNENDPNINPCRIINSCGHKRDASKMELN
FT                   KKGQLDIMRLLLAKESDTYYKSIEDWFDEDFLQSTFYLLWKTMFAFEQWQSLTELKRYM
FT                   HRFLQYLPGFSNLSCLRFSRYNQHDSFVVPLVKWLTEKGVNFQYDTLVYDVDLEITAHR
FT                   KIARGILWRDKEGGEHRIDMSAKDLVFVTNGSLTECTGYGDMDTPAPYHKDMQAGWELW
FT                   RNLVRRSPAFGRPDVFCGDADKTVWQSISFNFIGRDHPFLKKIKELTGNDPLSGRTVTG
FT                   GIITAEDSSWCISLTMNRQPQFHGQPEDWGVAWAYGLYPFEKGDVVNKTMLECTGEELL
FT                   KEYCYHFGLLDQFEEVKAHTKVRIATMPWITAFFMPRGKGDRPEVIPDGCVNLACLGQF
FT                   VETPDDCVFTTEGSARTAMMAVYGLLDLDRDIPPIWPTQYDIRSLLASAKTLNNGRLPG
FT                   SWLLSKLLKNTYYEDILP"
     MTNFQDIYQH SYPVSPDGNP FVQNDLGRYT QNHPVPPDDV AERKAYLVGS GIASLLAAAY        60
     LIRDAQMPGE NITILEEMSE PGGAFDGAGD TEKGFIARGG REMGQHFECF WDIMKDIPAL       120
     EMPEPYSVLD EFRIVNENDP NINPCRIINS CGHKRDASKM ELNKKGQLDI MRLLLAKESD       180
     TYYKSIEDWF DEDFLQSTFY LLWKTMFAFE QWQSLTELKR YMHRFLQYLP GFSNLSCLRF       240
     SRYNQHDSFV VPLVKWLTEK GVNFQYDTLV YDVDLEITAH RKIARGILWR DKEGGEHRID       300
     MSAKDLVFVT NGSLTECTGY GDMDTPAPYH KDMQAGWELW RNLVRRSPAF GRPDVFCGDA       360
     DKTVWQSISF NFIGRDHPFL KKIKELTGND PLSGRTVTGG IITAEDSSWC ISLTMNRQPQ       420
     FHGQPEDWGV AWAYGLYPFE KGDVVNKTML ECTGEELLKE YCYHFGLLDQ FEEVKAHTKV       480
     RIATMPWITA FFMPRGKGDR PEVIPDGCVN LACLGQFVET PDDCVFTTEG SARTAMMAVY       540
     GLLDLDRDIP PIWPTQYDIR SLLASAKTLN NGRLPGSWLL SKLLKNTYYE DILP             594
//

If you have problems or comments...

PBIL Back to PBIL home page