(data stored in ACNUC30630 zone)

EMBL: AE017283.PE108

AE017283.PE108       Location/Qualifiers
FT   CDS             complement(135938..136897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81873"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ4"
FT                   /protein_id="AAT81873.1"
FT                   /translation="MRENFELELRSNGGVARIVRDSPLRGQADRSVARGDTVRILPGVV
FT                   AATGAARHVTTMIQALKLWHRGATLVGMAALVLLGLKNPVTQRRWDYTGIQAIEAFSPT
FT                   RRLRRPRIWVHRWHVPHHFTIEEEGIRVAIPEVSVIILAIQGQWDWVCQALRQRLVTPA
FT                   SCRAVRKALTGRYSKAEVDRALADIDLNPWSIPELELARILRATGITGHKPNHQVWVGE
FT                   GNYRYVLDQAFQAEMLGVEMEGRSVHGTPEGYEAMMVRSAHLEQAGWRILHTTPTMLRR
FT                   DPKFVLDWIINHLHKRHRPKTTLTNQVLRQIMNSAVPA"
     MRENFELELR SNGGVARIVR DSPLRGQADR SVARGDTVRI LPGVVAATGA ARHVTTMIQA        60
     LKLWHRGATL VGMAALVLLG LKNPVTQRRW DYTGIQAIEA FSPTRRLRRP RIWVHRWHVP       120
     HHFTIEEEGI RVAIPEVSVI ILAIQGQWDW VCQALRQRLV TPASCRAVRK ALTGRYSKAE       180
     VDRALADIDL NPWSIPELEL ARILRATGIT GHKPNHQVWV GEGNYRYVLD QAFQAEMLGV       240
     EMEGRSVHGT PEGYEAMMVR SAHLEQAGWR ILHTTPTMLR RDPKFVLDWI INHLHKRHRP       300
     KTTLTNQVLR QIMNSAVPA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page