(data stored in ACNUC30630 zone)

EMBL: AE017283.PE115

AE017283.PE115       Location/Qualifiers
FT   CDS             145165..145689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81880"
FT                   /db_xref="InterPro:IPR027580"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI7"
FT                   /protein_id="AAT81880.1"
FT                   /translation="MHIIMHMPTRNVYVSDEDQNLFQEAAELAGGFSPAVSEALREYVK
FT                   RRKLMRGGAEQVEVDLRTDGIDHRVSFMGRRLVKVQRDHEQGCRIDTVYATARKQFAVV
FT                   SKVRRVLPSWAGGKEDLWSHPETWDKEFWTVGDRTLKVFANLDELRTADGELAERVDSA
FT                   LHVAPYEVLDI"
     MHIIMHMPTR NVYVSDEDQN LFQEAAELAG GFSPAVSEAL REYVKRRKLM RGGAEQVEVD        60
     LRTDGIDHRV SFMGRRLVKV QRDHEQGCRI DTVYATARKQ FAVVSKVRRV LPSWAGGKED       120
     LWSHPETWDK EFWTVGDRTL KVFANLDELR TADGELAERV DSALHVAPYE VLDI             174
//

If you have problems or comments...

PBIL Back to PBIL home page