(data stored in ACNUC30630 zone)

EMBL: AE017283.PE116

AE017283.PE116       Location/Qualifiers
FT   CDS             145752..145958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81881"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI6"
FT                   /protein_id="AAT81881.1"
FT                   /translation="MTVFARQKRFVTDQWTYYVESLTALARPHELCVRWSRGVYRALKR
FT                   PPEPCVVDFRGQSVRSLEMAQHF"
     MTVFARQKRF VTDQWTYYVE SLTALARPHE LCVRWSRGVY RALKRPPEPC VVDFRGQSVR        60
     SLEMAQHF                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page