(data stored in ACNUC30630 zone)

EMBL: AE017283.PE122

AE017283.PE122       Location/Qualifiers
FT   CDS             154728..156065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0129"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81887"
FT                   /db_xref="GOA:Q6ABI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABI0"
FT                   /protein_id="AAT81887.1"
FT                   /translation="MRRTAFIGPGRYQQAIGSLTSWGLVALVVVEALADFRHGLTSPPW
FT                   IVSSYLIVDVLIILACGPALWLRRHDLGRAGRWMLGGALGFMVWAIVSASFCPLPNLGP
FT                   GPVARLLLVMAPVTAVATLLAGLSVAAGLTIRSSGRMVIERLWWPAAAMTCVSYLQWPR
FT                   AMKVHGSTRLATGMGGSAVLHVALLLACGVLVAAAVAGCRRVASGILATGALVAVILTG
FT                   SRAGLACATLFVLGCAIGLVVWRRSRVVRRAGHRRMVWGALVALAVVVIGMVIVVPGLR
FT                   RMLNPSDPMRSRTLRTGIQVWSSDLNHVFFGLGSGRLWPWYLYDCHARQEPWRELMTTQ
FT                   WGPTLSSAHSTVLAVLVELGLLGFVLLLPVLLGPVVELVRRLFDGTGSPAEVVLRWAVV
FT                   ATLPAFLVDTYLVKNFGVSMWWWVVTLSSVAWTDQRPPSTSRQNSG"
     MRRTAFIGPG RYQQAIGSLT SWGLVALVVV EALADFRHGL TSPPWIVSSY LIVDVLIILA        60
     CGPALWLRRH DLGRAGRWML GGALGFMVWA IVSASFCPLP NLGPGPVARL LLVMAPVTAV       120
     ATLLAGLSVA AGLTIRSSGR MVIERLWWPA AAMTCVSYLQ WPRAMKVHGS TRLATGMGGS       180
     AVLHVALLLA CGVLVAAAVA GCRRVASGIL ATGALVAVIL TGSRAGLACA TLFVLGCAIG       240
     LVVWRRSRVV RRAGHRRMVW GALVALAVVV IGMVIVVPGL RRMLNPSDPM RSRTLRTGIQ       300
     VWSSDLNHVF FGLGSGRLWP WYLYDCHARQ EPWRELMTTQ WGPTLSSAHS TVLAVLVELG       360
     LLGFVLLLPV LLGPVVELVR RLFDGTGSPA EVVLRWAVVA TLPAFLVDTY LVKNFGVSMW       420
     WWVVTLSSVA WTDQRPPSTS RQNSG                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page