(data stored in ACNUC30630 zone)

EMBL: AE017283.PE126

AE017283.PE126       Location/Qualifiers
FT   CDS             complement(159976..160752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0133"
FT                   /product="hypothetical protein"
FT                   /note="putative Wzz (lipopolysaccharide biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81891"
FT                   /db_xref="GOA:Q6ABH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH6"
FT                   /protein_id="AAT81891.1"
FT                   /translation="MSSLPSEPTVAQSGSSAIEREGTTDSSTQPPRPRNPGQPIDLLGF
FT                   LKGLGHHWLAGLITFIVAAGLLVGYSLLMAPRNTVGTVAAHAHVMVTLPEPRTEAQATV
FT                   ESATVDQIMSNYVALTTPDPIVNAAVKYLHDGTTADDLKAGASVYWGGGGTVIAVYAMG
FT                   TNQNQAIERANAYARAFAEKANDLVPSSLASLPQPKLTIVQPAFPSDPNPNAPATNKNS
FT                   TKLSSPMVGVAAGLILGLVVMGVLEYRSSRRSRAPR"
     MSSLPSEPTV AQSGSSAIER EGTTDSSTQP PRPRNPGQPI DLLGFLKGLG HHWLAGLITF        60
     IVAAGLLVGY SLLMAPRNTV GTVAAHAHVM VTLPEPRTEA QATVESATVD QIMSNYVALT       120
     TPDPIVNAAV KYLHDGTTAD DLKAGASVYW GGGGTVIAVY AMGTNQNQAI ERANAYARAF       180
     AEKANDLVPS SLASLPQPKL TIVQPAFPSD PNPNAPATNK NSTKLSSPMV GVAAGLILGL       240
     VVMGVLEYRS SRRSRAPR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page