(data stored in ACNUC30630 zone)

EMBL: AE017283.PE130

AE017283.PE130       Location/Qualifiers
FT   CDS             163833..165215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0137"
FT                   /product="hypothetical protein"
FT                   /note="putative bicarbonate transporter, Ict family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81895"
FT                   /db_xref="GOA:Q6ABH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABH2"
FT                   /protein_id="AAT81895.1"
FT                   /translation="MTPIFRLHDSPDGSSAVTLLRSVAPIQWFSGAAEVIVACLFVTCT
FT                   FVTVAQPVFDNGACQLMLPLFAVAALVLEALCIVRDVRGVPSPREWSRSLTIVTCSFVA
FT                   LLVWAAVSIPFHEHLIYDDSMGVTRDLPLYALVMPLAEATVTLLVAIFACRMIAVGNLE
FT                   GALWRLSMLMAIANPIDLVREYVEGNTTGWRVATRLGGAAICHVLLILALAVAVDAVIR
FT                   HRHRILSSVAAVSHLGCLAASGSRAGTISLALFVIGLVFFGRSYRTRSRKQRTVIAMLG
FT                   LLTAGVAIWLVSTVRSGSLVDPARARTWALAGRVVVDSPSHFLVGTGYGTIWPWFAVES
FT                   TFMPESSHGMRRTLYGYSLPHAHSLIAQVVGELGVIGLALILVCLGTVIAVCVKGIRGG
FT                   YPLLSLGVLATMPAFLMDTYLIKNFPVALFWWIFTLALCRLVTTGDADVEGDSGYREEK
FT                   YA"
     MTPIFRLHDS PDGSSAVTLL RSVAPIQWFS GAAEVIVACL FVTCTFVTVA QPVFDNGACQ        60
     LMLPLFAVAA LVLEALCIVR DVRGVPSPRE WSRSLTIVTC SFVALLVWAA VSIPFHEHLI       120
     YDDSMGVTRD LPLYALVMPL AEATVTLLVA IFACRMIAVG NLEGALWRLS MLMAIANPID       180
     LVREYVEGNT TGWRVATRLG GAAICHVLLI LALAVAVDAV IRHRHRILSS VAAVSHLGCL       240
     AASGSRAGTI SLALFVIGLV FFGRSYRTRS RKQRTVIAML GLLTAGVAIW LVSTVRSGSL       300
     VDPARARTWA LAGRVVVDSP SHFLVGTGYG TIWPWFAVES TFMPESSHGM RRTLYGYSLP       360
     HAHSLIAQVV GELGVIGLAL ILVCLGTVIA VCVKGIRGGY PLLSLGVLAT MPAFLMDTYL       420
     IKNFPVALFW WIFTLALCRL VTTGDADVEG DSGYREEKYA                             460
//

If you have problems or comments...

PBIL Back to PBIL home page