(data stored in ACNUC30630 zone)

EMBL: AE017283.PE15

AE017283.PE15        Location/Qualifiers
FT   CDS             20350..21291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0017"
FT                   /product="periplasmic sugar-binding protein"
FT                   /note="putative ribose-specific"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81780"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP8"
FT                   /protein_id="AAT81780.1"
FT                   /translation="MKFKSTKVLATAVAVTIIATGVAGCNRDGGAGSSASGTVVFAVST
FT                   QTNPFFVQLVDGAKKEAKAKGVNLQVQDASDDAATQANQLANAVSTSAKVVIVNPTDSD
FT                   AVAPSVKALNKAKIPVITVDRSSSSGDVASFIASDNIAGGIDAAKKLAEIMGDKGEVIH
FT                   LQGTPGASASRDRGKGFSEEIAKHPGIKVVAKQTANFDRSKALDVTTNLMQAHSKATGI
FT                   FAENDEMAIGAISALGSKAGQSAKVVGFDGTADGIKAVKAGTMGATIAQQPAFLGKTAV
FT                   DQAADILAGKQVSKTTPIKVVLVTKDNAKDYE"
     MKFKSTKVLA TAVAVTIIAT GVAGCNRDGG AGSSASGTVV FAVSTQTNPF FVQLVDGAKK        60
     EAKAKGVNLQ VQDASDDAAT QANQLANAVS TSAKVVIVNP TDSDAVAPSV KALNKAKIPV       120
     ITVDRSSSSG DVASFIASDN IAGGIDAAKK LAEIMGDKGE VIHLQGTPGA SASRDRGKGF       180
     SEEIAKHPGI KVVAKQTANF DRSKALDVTT NLMQAHSKAT GIFAENDEMA IGAISALGSK       240
     AGQSAKVVGF DGTADGIKAV KAGTMGATIA QQPAFLGKTA VDQAADILAG KQVSKTTPIK       300
     VVLVTKDNAK DYE                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page