(data stored in ACNUC30630 zone)

EMBL: AE017283.PE151

AE017283.PE151       Location/Qualifiers
FT   CDS             complement(190665..191084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81916"
FT                   /db_xref="GOA:Q6ABF0"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABF0"
FT                   /protein_id="AAT81916.1"
FT                   /translation="MSHPSHFTAPSPSKRHPLRTLSRLGVGGLLAYAGVGHLTFVREEF
FT                   QAQVPDWVPVDDDTVVWLSGAAEIILGAALLSGRHKKFWGRSAAAFFAAIFPGNVGQLV
FT                   EHKDGFGLDDDRKRTIRLLFQPILVGLALEGTRED"
     MSHPSHFTAP SPSKRHPLRT LSRLGVGGLL AYAGVGHLTF VREEFQAQVP DWVPVDDDTV        60
     VWLSGAAEII LGAALLSGRH KKFWGRSAAA FFAAIFPGNV GQLVEHKDGF GLDDDRKRTI       120
     RLLFQPILVG LALEGTRED                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page