(data stored in ACNUC30630 zone)

EMBL: AE017283.PE159

AE017283.PE159       Location/Qualifiers
FT   CDS             201645..202439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0167"
FT                   /product="conserved protein"
FT                   /note="similarity to fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81924"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABE2"
FT                   /protein_id="AAT81924.1"
FT                   /translation="MTTTTSPGARATLPGLPGAGMTVGLFITCINDVMFPQTGVAVTTL
FT                   LERLGCKVEFPREQTCCAQMTTNTGYFDEGIPTVRQYVRAFGDYDYIVAPSGSCVAAVR
FT                   DQHPMLAEYAGDSGLAKEVEHTSQCTYDLPEFLVDILGVTDVGAYFPHRVTYHPSCHGK
FT                   RLLNLGDRPYELLRHVKGMTLVDLPMAEQCCGFGGTFCIKNPDMSAAMANDKARHVRET
FT                   EAEYVVAGDNSCLMNIGGVLSRQNSGVKPIHIAEILANTEED"
     MTTTTSPGAR ATLPGLPGAG MTVGLFITCI NDVMFPQTGV AVTTLLERLG CKVEFPREQT        60
     CCAQMTTNTG YFDEGIPTVR QYVRAFGDYD YIVAPSGSCV AAVRDQHPML AEYAGDSGLA       120
     KEVEHTSQCT YDLPEFLVDI LGVTDVGAYF PHRVTYHPSC HGKRLLNLGD RPYELLRHVK       180
     GMTLVDLPMA EQCCGFGGTF CIKNPDMSAA MANDKARHVR ETEAEYVVAG DNSCLMNIGG       240
     VLSRQNSGVK PIHIAEILAN TEED                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page