(data stored in ACNUC30630 zone)

EMBL: AE017283.PE16

AE017283.PE16        Location/Qualifiers
FT   CDS             21288..22217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0018"
FT                   /product="sugar kinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81781"
FT                   /db_xref="GOA:Q6ABP7"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP7"
FT                   /protein_id="AAT81781.1"
FT                   /translation="MSGATAKVTVVGSINADMRVGVERFPGPGETLAGGEATLTPGGKG
FT                   ANQALAAARCGVQVAMVGAVGKDPTAETALSLLSEGVGLDGVVRRDVLTGTAVVMVADS
FT                   GENSIIVIAAANGTVDAQTVRAQAERIQDADVVVCQGEIPPDGIAEAARGAKRFVFNLA
FT                   PVVDVDPEVIRMADPLVVNEHEAALVALALGSTTSRLEDDPDAALRELLNLGCRSVVIT
FT                   LGSAGCIVGGPEGFDAVAAATVKAVDTVGAGDAFVGALAAELARGRTLVEGCRFATAVA
FT                   TLTVTKPGAQASYPSADEVESIRRGEHA"
     MSGATAKVTV VGSINADMRV GVERFPGPGE TLAGGEATLT PGGKGANQAL AAARCGVQVA        60
     MVGAVGKDPT AETALSLLSE GVGLDGVVRR DVLTGTAVVM VADSGENSII VIAAANGTVD       120
     AQTVRAQAER IQDADVVVCQ GEIPPDGIAE AARGAKRFVF NLAPVVDVDP EVIRMADPLV       180
     VNEHEAALVA LALGSTTSRL EDDPDAALRE LLNLGCRSVV ITLGSAGCIV GGPEGFDAVA       240
     AATVKAVDTV GAGDAFVGAL AAELARGRTL VEGCRFATAV ATLTVTKPGA QASYPSADEV       300
     ESIRRGEHA                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page