(data stored in ACNUC30630 zone)

EMBL: AE017283.PE17

AE017283.PE17        Location/Qualifiers
FT   CDS             22214..22597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0019"
FT                   /product="high affinity ribose transport protein RbsD"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81782"
FT                   /db_xref="GOA:Q6ABP6"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ABP6"
FT                   /protein_id="AAT81782.1"
FT                   /translation="MKKSGLLNPQLCAAVARLGHTQTFVVADAGLPIPHEVPVIDLAVV
FT                   LGTPRFQEVFDAILDEVVVDGATIAHEALGHEPESWVRERIEEVHTVSHEDLKKALPNV
FT                   SFVVRTGETTPYSNVIVRCGVPF"
     MKKSGLLNPQ LCAAVARLGH TQTFVVADAG LPIPHEVPVI DLAVVLGTPR FQEVFDAILD        60
     EVVVDGATIA HEALGHEPES WVRERIEEVH TVSHEDLKKA LPNVSFVVRT GETTPYSNVI       120
     VRCGVPF                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page