(data stored in ACNUC30630 zone)

EMBL: AE017283.PE175

AE017283.PE175       Location/Qualifiers
FT   CDS             complement(222534..222815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0182"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81940"
FT                   /db_xref="GOA:Q6ABC6"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC6"
FT                   /protein_id="AAT81940.1"
FT                   /translation="MPESKVRPQAKKKAQAKDRATMDERRAEKKAAPVDRSWVPKVFVP
FT                   LFLLGVLWLIVYYIAGNQIPGISDLGDWNILIGMGLMAAGFGVATLWK"
     MPESKVRPQA KKKAQAKDRA TMDERRAEKK AAPVDRSWVP KVFVPLFLLG VLWLIVYYIA        60
     GNQIPGISDL GDWNILIGMG LMAAGFGVAT LWK                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page