(data stored in ACNUC30630 zone)

EMBL: AE017283.PE195

AE017283.PE195       Location/Qualifiers
FT   CDS             complement(245019..247880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0199"
FT                   /product="RHS-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81960"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA6"
FT                   /protein_id="AAT81960.1"
FT                   /translation="MERDLAGRIVALVSPTGLRTSYSYDACGRMVDVTDPAGRVTRYSY
FT                   TSDFQVATVTYPTGETARYEYDAMGRVVLSHVPGAGVSQYRYDPCGRLVFSCDLVYGQR
FT                   HFSYDLAGQLVAATNPAGGVSRYGYDRCGRLVTRTDPGGGLTTYQYNECGQMIAATDPL
FT                   GRVTEYTWDKSGTLAAITRPDGTVVSRRLGPKGVEEYIDDQLVSRILITPTTRTVTIDD
FT                   YTDPAFPWRHLLGYDPRGLLLTHSVAPVPGDESIVDEGPLTSSEQWWYDAEGRRVRHLT
FT                   LTGDSIDYAYTNTGVLGSIRHSRLGEVSLEWDAVGRLAKLGSPLDQQQWGYTDGFVTSH
FT                   TSSRGSTTISRDEMGRVLRVSAPYGDFRYGYDDSGSLTSADGLDGSSRRWVYDTAGRLV
FT                   TTTCQDAGTSQTCHYDYDLAGELVSTVTQLGPGDSTVETHYRYDPCGRRIEAASSAGMR
FT                   EEFRWDSRGWLAGVMTFRAGRSHEFATHVDAFGCLTDVSGPAGRTPIAWDLATGEPQLV
FT                   QVGGIPALPLPDGSVLTPVSADSDQDEPWRRPATDPLDPYTLIQEHLTAGISMTGGHLG
FT                   VAGLAWMGARVYDSTTASFLTIDPLAAPPGSLWEAASYGYAATNPLALADPLGLRPVTD
FT                   AQMRQFASTIDTRNLWDRHIRNVFSWETLGGVALATAGGLLMCFGAEVPGAMLIGAGGD
FT                   MVFQQVVRGHVDYGEVALSGALAPTGGSGLSEIAGLGTRTLLTRGIEAGTTQGYVMGNY
FT                   HWVTSPGPHNAETYLEQVGGETLSGAAFGGITATIGGKTYDALPDSIPTGHFGPHNTIL
FT                   RVGKQPETFIRKYQRNGKLDFGQATSFRGATFKSKIAIKPITTYRSWSDPDYEVGGYVS
FT                   RTRPAGPLQTQLDLALAPQWGNKANHISEYEIPQFAPFYEGAAGVQPVKAIEDSDTLGQ
FT                   LPGGGNQILITDKQVLDRWKSKK"
     MERDLAGRIV ALVSPTGLRT SYSYDACGRM VDVTDPAGRV TRYSYTSDFQ VATVTYPTGE        60
     TARYEYDAMG RVVLSHVPGA GVSQYRYDPC GRLVFSCDLV YGQRHFSYDL AGQLVAATNP       120
     AGGVSRYGYD RCGRLVTRTD PGGGLTTYQY NECGQMIAAT DPLGRVTEYT WDKSGTLAAI       180
     TRPDGTVVSR RLGPKGVEEY IDDQLVSRIL ITPTTRTVTI DDYTDPAFPW RHLLGYDPRG       240
     LLLTHSVAPV PGDESIVDEG PLTSSEQWWY DAEGRRVRHL TLTGDSIDYA YTNTGVLGSI       300
     RHSRLGEVSL EWDAVGRLAK LGSPLDQQQW GYTDGFVTSH TSSRGSTTIS RDEMGRVLRV       360
     SAPYGDFRYG YDDSGSLTSA DGLDGSSRRW VYDTAGRLVT TTCQDAGTSQ TCHYDYDLAG       420
     ELVSTVTQLG PGDSTVETHY RYDPCGRRIE AASSAGMREE FRWDSRGWLA GVMTFRAGRS       480
     HEFATHVDAF GCLTDVSGPA GRTPIAWDLA TGEPQLVQVG GIPALPLPDG SVLTPVSADS       540
     DQDEPWRRPA TDPLDPYTLI QEHLTAGISM TGGHLGVAGL AWMGARVYDS TTASFLTIDP       600
     LAAPPGSLWE AASYGYAATN PLALADPLGL RPVTDAQMRQ FASTIDTRNL WDRHIRNVFS       660
     WETLGGVALA TAGGLLMCFG AEVPGAMLIG AGGDMVFQQV VRGHVDYGEV ALSGALAPTG       720
     GSGLSEIAGL GTRTLLTRGI EAGTTQGYVM GNYHWVTSPG PHNAETYLEQ VGGETLSGAA       780
     FGGITATIGG KTYDALPDSI PTGHFGPHNT ILRVGKQPET FIRKYQRNGK LDFGQATSFR       840
     GATFKSKIAI KPITTYRSWS DPDYEVGGYV SRTRPAGPLQ TQLDLALAPQ WGNKANHISE       900
     YEIPQFAPFY EGAAGVQPVK AIEDSDTLGQ LPGGGNQILI TDKQVLDRWK SKK              953
//

If you have problems or comments...

PBIL Back to PBIL home page