(data stored in ACNUC30630 zone)

EMBL: AE017283.PE206

AE017283.PE206       Location/Qualifiers
FT   CDS             complement(261018..262853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0210"
FT                   /product="conserved membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81971"
FT                   /db_xref="GOA:Q6AB95"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB95"
FT                   /protein_id="AAT81971.1"
FT                   /translation="MAEKRSGARSGSASRNHLRSWHGDDPIPRTADGIDARIFRPGQAS
FT                   AQPATPPQSSATPSKPPVDEDNPTKIAPVGSLSRSWPLTRSRTTSPHNGQAKLRHSRPP
FT                   RAHRTRRVPLEKLFRARTPVEPTLALNLGDAEMAIMQARRVVDLVTRVAVMAISVGGSA
FT                   SEAVAIALRITATYGVTVHIDITNTSVIVTQHRGLDEDPITALRVVRSRSNDYQRLGEL
FT                   QLLVDDICDKTVSLEEAADRLAAITRSPRLYRQWFVTMNIGLMGAGLSTLFGGTVMDGV
FT                   LSFFSTCIVDATVQAMARKRITNFFAQAAGGAIATAFALIVMVYMAASNHPLPLSPSLI
FT                   VAAGIVSLLAGGSFVAASQDALDGYVVTSSGRFLEGFVQTGGVILGVITAMWIGLRLGV
FT                   PGYISPALGFSTNPVLQMVAAAVIAVTFGVSSHAGYRTLAICAALGAAAWAGYLLGMQL
FT                   TGSVSAASGLAAMVAGFIAGLGAKRWKVPQLGLVTIAIVPLMPGVMMYRALYMIVNAQN
FT                   ETGGTSSAGWTLFLEALLVGVALAVGGSFGALLARPFTLPKDLRSRLATLASWGAGQAV
FT                   PRERRRRRSQPPADPHHPALNNTETDPTVTGTWAR"
     MAEKRSGARS GSASRNHLRS WHGDDPIPRT ADGIDARIFR PGQASAQPAT PPQSSATPSK        60
     PPVDEDNPTK IAPVGSLSRS WPLTRSRTTS PHNGQAKLRH SRPPRAHRTR RVPLEKLFRA       120
     RTPVEPTLAL NLGDAEMAIM QARRVVDLVT RVAVMAISVG GSASEAVAIA LRITATYGVT       180
     VHIDITNTSV IVTQHRGLDE DPITALRVVR SRSNDYQRLG ELQLLVDDIC DKTVSLEEAA       240
     DRLAAITRSP RLYRQWFVTM NIGLMGAGLS TLFGGTVMDG VLSFFSTCIV DATVQAMARK       300
     RITNFFAQAA GGAIATAFAL IVMVYMAASN HPLPLSPSLI VAAGIVSLLA GGSFVAASQD       360
     ALDGYVVTSS GRFLEGFVQT GGVILGVITA MWIGLRLGVP GYISPALGFS TNPVLQMVAA       420
     AVIAVTFGVS SHAGYRTLAI CAALGAAAWA GYLLGMQLTG SVSAASGLAA MVAGFIAGLG       480
     AKRWKVPQLG LVTIAIVPLM PGVMMYRALY MIVNAQNETG GTSSAGWTLF LEALLVGVAL       540
     AVGGSFGALL ARPFTLPKDL RSRLATLASW GAGQAVPRER RRRRSQPPAD PHHPALNNTE       600
     TDPTVTGTWA R                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page