(data stored in ACNUC30630 zone)

EMBL: AE017283.PE211

AE017283.PE211       Location/Qualifiers
FT   CDS             266814..267404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81976"
FT                   /db_xref="GOA:Q6AB90"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB90"
FT                   /protein_id="AAT81976.1"
FT                   /translation="MLGWRAWARNRSLLSLLAATVVCCVLIGLTSEVIIAIPPFLTGRG
FT                   VDVSNAAVVPLCVVIVQGWCLSRRDTRLEAGSERRTALADCLLSTTPAVLVGIVAYVGN
FT                   LPVGMVATRNTVGLSGVTLLANALGVTRLSSLPATIWVLMSLLAGSTASFEAPWSWPVK
FT                   DRTDVLSAVLSVALCLLGISASLVKPRPWRNRG"
     MLGWRAWARN RSLLSLLAAT VVCCVLIGLT SEVIIAIPPF LTGRGVDVSN AAVVPLCVVI        60
     VQGWCLSRRD TRLEAGSERR TALADCLLST TPAVLVGIVA YVGNLPVGMV ATRNTVGLSG       120
     VTLLANALGV TRLSSLPATI WVLMSLLAGS TASFEAPWSW PVKDRTDVLS AVLSVALCLL       180
     GISASLVKPR PWRNRG                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page